Structure of PDB 7mpj Chain Ae

Receptor sequence

>7mpjAe (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Ae	K8 K11 K12 T14 K15 K16 F17 R19 H20 H21 D23 R24 Y25 H26 R27 V28 W32 R33 K34 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 I50 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K64 F65 P68 L75 N78 E95 A97 H98 N99 S101 K103 N104 R105 N121 G124 R125	K7 K10 K11 T13 K14 K15 F16 R18 H19 H20 D22 R23 Y24 H25 R26 V27 W31 R32 K33 K35 G36 I37 D38 S39 R42 R43 R44 F45 R46 I49 P52 K53 I54 G55 Y56 G57 S58 N59 K60 K63 F64 P67 L74 N77 E94 A96 H97 N98 S100 K102 N103 R104 N120 G123 R124
BS02	MG	Ae	K16 F17	K15 F16
BS03	MG	Ae	R19 A29 N31	R18 A28 N30
BS04	MG	Ae	D39 V41	D38 V40

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
PDBsum	7mpj
PubMed	35489333
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)