Structure of PDB 7mpi Chain Ae

Receptor sequence

>7mpiAe (length=127) Species: 4932 (Saccharomyces cerevisiae)

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

• PDB: 7mpi CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: Ae
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ae	K11 K12 K15 K16 F17 R19 H21 D23 R24 Y25 H26 R27 V28 W32 R33 K34 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 G48 I50 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 F65 P68 S69 L75 N78 K80 E95 A97 H98 N99 I100 S101 K103 N104 R105 N121 G124 R125	K10 K11 K14 K15 F16 R18 H20 D22 R23 Y24 H25 R26 V27 W31 R32 K33 K35 G36 I37 D38 S39 R42 R43 R44 F45 R46 G47 I49 P52 K53 I54 G55 Y56 G57 S58 N59 K60 K61 K63 F64 P67 S68 L74 N77 K79 E94 A96 H97 N98 I99 S100 K102 N103 R104 N120 G123 R124
BS02	MG	Ae	K16 F17	K15 F16
BS03	MG	Ae	R19 A29 N31	R18 A28 N30

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mpi, PDBe:7mpi, PDBj:7mpi
• PDBsum: 7mpi
• PubMed: 35489333
• UniProt: P38061|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)