Structure of PDB 6z1p Chain Ae

Receptor sequence

>6z1pAe (length=337) Species: 312017 (Tetrahymena thermophila SB210)

SITNYSIKPVKYELKINEQPGKMPILVRKPDEILVKQWWSQSPFEKTQPL
RVPVLKFLAENGQAYTGKTVDLDHDIFNVPLRRDIVHSYVLWRQNRDEIK
THITKTKGTVSGSGKKPYAQKGTGKARMGNKRAPGRKKGGKAHGAKPRIL
RYPLNKKIRLQALKVVLSAKLAEGKLRIIETEQVDEPKTRAIAKMLEKMD
KRSRILIVHPYQIDTNFELAHQNIQKLQSCYPNELSVLKVLTNDRVFITL
EALRQLTQELQDRTFRNYRMKHVERGVTESEAEREQVWPTPKQQDTKVIY
DPTKPLQFKFKILQDYYEQYEKLKENGEIQKYRENIE

3D structure

• PDB: 6z1p Ciliate mitoribosome illuminates evolutionary steps of mitochondrial translation.
• Chain: Ae
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ae	T122 K209 T210 R211 N244 Q246	T101 K188 T189 R190 N223 Q225
BS02	rna	Ae	R103 H108 Y110 R114 R117 K121 T122 H123 T125 K126 T127 K128 S132 G133 S134 K136 K137 Q141 K142 G145 K146 A147 R148 G150 N151 R153 G156 R157 K158 K159 K162 A163 H164 K167 R169 R172 Y173 P174 N176 K177 K178 I179 R180 R225 Q246 K247 N254 E255 R285 R288 Y290 M292	R82 H87 Y89 R93 R96 K100 T101 H102 T104 K105 T106 K107 S111 G112 S113 K115 K116 Q120 K121 G124 K125 A126 R127 G129 N130 R132 G135 R136 K137 K138 K141 A142 H143 K146 R148 R151 Y152 P153 N155 K156 K157 I158 R159 R204 Q225 K226 N233 E234 R263 R266 Y268 M270

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6z1p, PDBe:6z1p, PDBj:6z1p
• PDBsum: 6z1p
• PubMed: 32553108
• UniProt: I7MGP2