Structure of PDB 5a9z Chain Ae

Receptor sequence

>5a9zAe (length=64) Species: 300852 (Thermus thermophilus HB8)

MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVL
AKPEAERIKLLLPY

3D structure

• PDB: 5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
• Chain: Ae
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ae	M1 P2 K3 M4 K5 H7 K8 K11 K12 T17 S19 K21 M25 G28 K29 R30 H31 L32 N33 W34 Q35 K39 I41 R42 R46 K47 V49 K52 I58 K59 L61 L62 Y64	M1 P2 K3 M4 K5 H7 K8 K11 K12 T17 S19 K21 M25 G28 K29 R30 H31 L32 N33 W34 Q35 K39 I41 R42 R46 K47 V49 K52 I58 K59 L61 L62 Y64

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
• PDBsum: 5a9z
• PubMed: 26283392
• UniProt: Q5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)