Structure of PDB 3jbp Chain Ae

Receptor sequence
>3jbpAe (length=43) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
GSIKRFRLKQRLGKCRRQNRPVPHWYRLKNTKRRHWRRTKLGL
3D structure
PDB3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.
ChainAe
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Ae G2 S3 I4 K5 R6 K10 L13 R17 T39 R41 R42 W44 R45 K48 L49 G1 S2 I3 K4 R5 K9 L12 R16 T31 R33 R34 W36 R37 K40 L41
BS02 rna Ae R6 F7 R8 R12 K15 R18 R21 P24 W26 Y27 K40 R5 F6 R7 R11 K14 R17 R20 P23 W25 Y26 K32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum3jbp
PubMed26432834
UniProtC0H4H3

[Back to BioLiP]