Structure of PDB 3jbn Chain Ae

Receptor sequence
>3jbnAe (length=43) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
GSIKRFRLKQRLGKCRRQNRPVPHWYRLKNTKRRHWRRTKLGL
3D structure
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
ChainAe
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ae G2 S3 I4 K5 K10 L13 R21 P22 Y27 T39 K40 R41 R42 H43 W44 R45 K48 L49 G1 S2 I3 K4 K9 L12 R20 P21 Y26 T31 K32 R33 R34 H35 W36 R37 K40 L41
BS02 rna Ae R6 F7 R8 R12 K15 R18 Q19 V23 P24 W26 Y27 L29 K30 R5 F6 R7 R11 K14 R17 Q18 V22 P23 W25 Y26 L28 K29
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtC0H4H3

[Back to BioLiP]