Structure of PDB 9cai Chain Ad

Receptor sequence
>9caiAd (length=55) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
GFQNLWFSHPRKFGPGSRSCRVCAGHHGLIRKYGLDLCRRCFREQARDIG
FKKLD
3D structure
PDB9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.
ChainAd
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ad G2 F3 N5 L6 W7 F8 H10 R12 K13 F14 G15 G17 R19 C24 H28 G29 L30 I31 R32 K33 Y34 R40 R41 R44 E45 K54 D56 G1 F2 N4 L5 W6 F7 H9 R11 K12 F13 G14 G16 R18 C23 H27 G28 L29 I30 R31 K32 Y33 R39 R40 R43 E44 K53 D55
External links