Structure of PDB 8tpu Chain Ad

Receptor sequence
>8tpuAd (length=72) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
PKQITDIRKFLKISRKPDTTAVIIMKKKSKTVITKLKLRTKKYLYTMVFA
DRKKAERIENSLLPSLKRIYYP
3D structure
PDB8tpu Divergent translational landscape reflects adaptation to biased codon usage in malaria parasites
ChainAd
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ad P2 K3 Q4 T6 K10 K17 D19 M26 K28 K31 I38 K40 K42 R44 K47 Y48 L49 Y50 T51 Y76 P1 K2 Q3 T5 K9 K16 D18 M25 K27 K30 I33 K35 K37 R39 K42 Y43 L44 Y45 T46 Y71
External links