Structure of PDB 8ois Chain Ad

Receptor sequence

>8oisAd (length=343) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 8ois Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: Ad
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ad	T91 L93 K100 G101 A104 G109 K111 R114 R117 K119 R136 R191 S194 G195 N196 R226 V228 F229 T230 M231 T232 A233 K234 R237 R242 F256 K260 D266 R269 R297 F298 K299 R300 C316 H317 R318 Y333 A334 K335 S339 N341 L343 Q347 W408 K418 R419 V421 W422 S423 R427	T4 L6 K13 G14 A17 G22 K24 R27 R30 K32 R49 R104 S107 G108 N109 R139 V141 F142 T143 M144 T145 A146 K147 R150 R155 F169 K173 D179 R182 R210 F211 K212 R213 C229 H230 R231 Y246 A247 K248 S252 N254 L256 Q260 W321 K331 R332 V334 W335 S336 R340
BS02	MG	Ad	F229 R237	F142 R150

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ois, PDBe:8ois, PDBj:8ois
• PDBsum: 8ois
• PubMed: 37141370
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)