Structure of PDB 8fmw Chain Ad

Receptor sequence
>8fmwAd (length=59) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]
AVPKFKPSKSRSRTRRSINMRKKIPQFQECSNCGNLGVRHRICLKCGYYR
NNQYLEIGL
3D structure
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
ChainAd
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ad A2 V3 P4 K5 F6 K7 S9 K10 S11 R12 S13 R14 T15 R17 S18 I19 N20 M21 K23 Q27 Q29 E30 S32 R40 H41 Y50 R51 L60 A1 V2 P3 K4 F5 K6 S8 K9 S10 R11 S12 R13 T14 R16 S17 I18 N19 M20 K22 Q26 Q28 E29 S31 R39 H40 Y49 R50 L59
BS02 ZN Ad C31 C44 C47 C30 C43 C46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum8fmw
PubMed37907464
UniProtO51646|RL32_BORBU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]