Structure of PDB 6z1p Chain Ad

Receptor sequence

>6z1pAd (length=374) Species: 312017 (Tetrahymena thermophila SB210)

SKWSKPQKQHRQKERRTGVAISDEKAAKDKPLRTQSFEHDQSITDDKLFK
MLQDYTFKFEGKKINPPEKVIYSDPTQVPARATPSLKNKVEINHFNCEEI
VNKKFEGQIKQFEPTKTSKRTGILGYKLGMTSIWDKWGKLHALTVIQIDR
CQVVQVKTEEKDGVNALQLGVGEKSLKRINKPTIGHLMKNDIPPKRHLKE
FKVSPDCFLPAGYMLSARHFVPGQYVDIQGISVGKGFAGTVKRWNFKMQD
ATHGNSLSHRAPGSTGQRQDPGRVFKNKKMAGHMGCEKVTIMDLQVYKID
VERSLVYIRGHVPGKPGSLVQIRDAFKKQVQNEQFLNFPTFVAGKNDKLA
TVLIMEASKSDPNEEYIHDNDVVD

3D structure

• PDB: 6z1p Ciliate mitoribosome illuminates evolutionary steps of mitochondrial translation.
• Chain: Ad
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ad	K59 S150 L151 K152 N153 V155 M195 Q220 D227 Q233 K242 R243 N245 K246 P247 G250 H251 K254 L263 K264 E265 S297 V298 G299 K300 G301 F302 G304 R308 K312 M313 A316 T317 H318 G319 S321 L322 S323 H324 R325 P327 G328 S329 T330 Q332 R333 Q334 D335 P336 R338 V339 N342 K343 M345 A346 H348 C351 K353 T355 R374 H376 V377 K380 K392 D436	K28 S85 L86 K87 N88 V90 M130 Q155 D162 Q168 K177 R178 N180 K181 P182 G185 H186 K189 L198 K199 E200 S232 V233 G234 K235 G236 F237 G239 R243 K247 M248 A251 T252 H253 G254 S256 L257 S258 H259 R260 P262 G263 S264 T265 Q267 R268 Q269 D270 P271 R273 V274 N277 K278 M280 A281 H283 C286 K288 T290 R309 H311 V312 K315 K327 D371
BS02	rna	Ad	S32 K33 K36	S1 K2 K5
BS03	rna	Ad	W34 P37 V50	W3 P6 V19

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6z1p, PDBe:6z1p, PDBj:6z1p
• PDBsum: 6z1p
• PubMed: 32553108
• UniProt: Q22HG3