Structure of PDB 5a9z Chain Ad

Receptor sequence
>5a9zAd (length=49) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR
3D structure
PDB5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
ChainAd
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ad M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 M22 R23 R28 K29 V30 K32 R33 R34 G38 R39 W40 R47 K48 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 M22 R23 R28 K29 V30 K32 R33 R34 G38 R39 W40 R47 K48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum5a9z
PubMed26283392
UniProtP80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]