Structure of PDB 4v6w Chain Ad

Receptor sequence
>4v6wAd (length=52) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
TLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKK
LD
3D structure
PDB4v6w Structures of the human and Drosophila 80S ribosome.
ChainAd
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ad W7 Y8 S9 H10 R12 Y14 G15 Q16 R19 C24 N26 R27 H28 G29 L30 R32 K33 Y34 R40 Q41 R44 E45 D56 W3 Y4 S5 H6 R8 Y10 G11 Q12 R15 C20 N22 R23 H24 G25 L26 R28 K29 Y30 R36 Q37 R40 E41 D52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6w, PDBe:4v6w, PDBj:4v6w
PDBsum4v6w
PubMed23636399
UniProtQ9VH69|RS29_DROME Small ribosomal subunit protein uS14 (Gene Name=RpS29)

[Back to BioLiP]