Structure of PDB 5t0c Chain Ac

Receptor sequence
>5t0cAc (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]
AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVF
AMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLS
GVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHE
PRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKK
SWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIK
NVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
3D structure
PDB5t0c Structural basis for dynamic regulation of the human 26S proteasome.
ChainAc
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.4.19.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN Ac H113 H115 D126 H90 H92 D103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
GO:0061133 endopeptidase activator activity
GO:0061578 K63-linked deubiquitinase activity
GO:0070628 proteasome binding
GO:0140492 metal-dependent deubiquitinase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006508 proteolysis
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016579 protein deubiquitination
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045471 response to ethanol
GO:0061136 regulation of proteasomal protein catabolic process
GO:0070536 protein K63-linked deubiquitination
Cellular Component
GO:0000502 proteasome complex
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0008541 proteasome regulatory particle, lid subcomplex
GO:0022624 proteasome accessory complex
GO:0031597 cytosolic proteasome complex
GO:0034774 secretory granule lumen
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t0c, PDBe:5t0c, PDBj:5t0c
PDBsum5t0c
PubMed27791164
UniProtO00487|PSDE_HUMAN 26S proteasome non-ATPase regulatory subunit 14 (Gene Name=PSMD14)

[Back to BioLiP]