Structure of PDB 5a9z Chain Ac

Receptor sequence
>5a9zAc (length=49) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI
3D structure
PDB5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
ChainAc
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ac I7 L9 Y21 T23 E24 K27 R28 N29 T30 P31 N32 R37 K38 Y39 K45 H46 I2 L4 Y16 T18 E19 K22 R23 N24 T25 P26 N27 R32 K33 Y34 K40 H41
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum5a9z
PubMed26283392
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]