Structure of PDB 3jbp Chain Ac

Receptor sequence

>3jbpAc (length=89) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

GKAGKGTGSFGKRNGKTHFLCLRCGKRSYHLQKKKCASCGYPSAKKRRFN
WSVKAKRRNTTGTGRCRYIKTLRRKLKNKFTEGSTPKPK

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ac	G2 K3 K6 G7 T8 S10 F11 G12 K13 R14 N15 G16 K17 H19 K27 R28 S29 Q33 K34 A38 K46 K47 R48 R49 N51 W52 K55 R58 R59 T62 R74 G84 S85 T86 K88	G1 K2 K5 G6 T7 S9 F10 G11 K12 R13 N14 G15 K16 H18 K26 R27 S28 Q32 K33 A37 K45 K46 R47 R48 N50 W51 K54 R57 R58 T61 R73 G83 S84 T85 K87
BS02	rna	Ac	F20 R24 Y30 L32 K35 T62 G63 G65 R66 C67 R68 Y69 I70 K71 R75 K78 N79 F81 S85 T86 P87 P89 K90	F19 R23 Y29 L31 K34 T61 G62 G64 R65 C66 R67 Y68 I69 K70 R74 K77 N78 F80 S84 T85 P86 P88 K89

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links