Structure of PDB 7nsi Chain Ab

Receptor sequence

>7nsiAb (length=135) Species: 9823 (Sus scrofa)

AGSRLETVGSIFSRTRDLIRAGVLKEKPLWLDIYNAFPPLREPVFRRPRL
RYGKAKAAVQDIFYHEDRIRAKFYSAYGSGPKAFDLFNPNFKSTCQRFVE
KYIELQRLGETDEEKLFVEAGKALLAEGVTLRRVG

3D structure

• PDB: 7nsi Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
• Chain: Ab
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ab	R5 R48 R50 Y53 G54 K55 A56	R4 R47 R49 Y52 G53 K54 A55

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 22:46:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nsi', asym_id = 'Ab', title = 'Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nsi', asym_id='Ab', title='Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005739,0005840,0006412', uniprot = '', pdbid = '7nsi', asym_id = 'Ab'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005739,0005840,0006412', uniprot='', pdbid='7nsi', asym_id='Ab')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>