Structure of PDB 7mpj Chain Ab

Receptor sequence

>7mpjAb (length=58) Species: 4932 (Saccharomyces cerevisiae)

AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK

3D structure

• PDB: 7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: Ab
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ab	A2 K3 K5 N6 H7 T8 A9 H10 N11 Q12 T13 R14 K15 H17 R18 N19 Y27 K28 Y29 P30 S31 L32 K33 G34 D36 P37 K38 F39 R40 R41 N42 H43 K44 H45 A46 G49 T50 L54	A1 K2 K4 N5 H6 T7 A8 H9 N10 Q11 T12 R13 K14 H16 R17 N18 Y26 K27 Y28 P29 S30 L31 K32 G33 D35 P36 K37 F38 R39 R40 N41 H42 K43 H44 A45 G48 T49 L53
BS02	MG	Ab	K15 R18	K14 R17
BS03	MG	Ab	K15 A16	K14 A15

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
• PDBsum: 7mpj
• PubMed: 35489333
• UniProt: P05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)