Structure of PDB 6xyw Chain Ab

Receptor sequence

>6xywAb (length=155) Species: 3702 (Arabidopsis thaliana)

NSMIGSSMPLGMMRIGTIIHNIEMNPGQGAKMVRAAGTNAKILKEPAKGK
CLIKLPSGDTKWINAKCRATIGTVSNPSHGTKKLYKAGQSRWLGIRPKVR
GVAMNPCDHPHGGGEGKSKSSGSRGRTSVSPWGKPCKGGYKSASVKKKKK
RLAEA

3D structure

• PDB: 6xyw Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
• Chain: Ab
• Resolution: 3.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ab	K86 M87 V88 R89 A90 A91 G92 L110 S112 D114 K116 H134 G135 K138 L139 Y140 K141 A142 G143 R146 W147 R151 P152 K153 V154 R155 G156 V157 A158 M159 N160 C162 D163 G169 E170 G171 K172 S175 S176 G177 S178 R179 G180 R181 T182 S183 W187 C191 K192 G193 G194 Y195 K196 A198 K201 K202 K203	K31 M32 V33 R34 A35 A36 G37 L55 S57 D59 K61 H79 G80 K83 L84 Y85 K86 A87 G88 R91 W92 R96 P97 K98 V99 R100 G101 V102 A103 M104 N105 C107 D108 G114 E115 G116 K117 S120 S121 G122 S123 R124 G125 R126 T127 S128 W132 C136 K137 G138 G139 Y140 K141 A143 K146 K147 K148

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xyw, PDBe:6xyw, PDBj:6xyw
• PDBsum: 6xyw
• PubMed: 32251374
• UniProt: Q8VZU4|RM02C_ARATH Large ribosomal subunit protein uL2my, C-terminal part (Gene Name=RPL2-C)