Structure of PDB 6eri Chain Ab

Receptor sequence
>6eriAb (length=60) Species: 3562 (Spinacia oleracea) [Search protein sequence]
DVRVKVILECTGCVRKSVNKGSRGVSRYITQKNRHNTPSRLELRKFCPYC
YKHTIHGEIK
3D structure
PDB6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.
ChainAb
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ab R8 K10 K21 K25 R28 R32 Y33 T35 Q36 N41 T42 R49 K50 F51 Y56 H58 R3 K5 K16 K20 R23 R27 Y28 T30 Q31 N36 T37 R44 K45 F46 Y51 H53
BS02 ZN Ab C52 C55 C47 C50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum6eri
PubMed29610536
UniProtP28805|RK33_SPIOL Large ribosomal subunit protein bL33c (Gene Name=rpl33)

[Back to BioLiP]