Structure of PDB 6tvq Chain AaA

Receptor sequence
>6tvqAaA (length=38) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
3D structure
PDB6tvq Systematic Evaluation of Fluorination as Modification for Peptide-Based Fusion Inhibitors against HIV-1 Infection.
ChainAaA
Resolution1.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide AaA Q612 Q616 I622 K623 Q626 K637 D638 Q639 Q11 Q15 I21 K22 Q25 K36 D37 Q38
External links