Structure of PDB 4v4n Chain Aa

Receptor sequence
>4v4nAa (length=82) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
KAGEEVIFTVPIKKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIIDPK
VNEKIWERGIEKPPSKLRVKVKVETVRIAYVT
3D structure
PDB4v4n Structure of the SecY channel during initiation of protein translocation.
ChainAa
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Aa F11 T12 P14 K16 K19 K20 I21 V22 P23 R24 W25 K26 R30 V32 F34 R41 H42 K44 I49 I50 D51 N55 E56 W59 E60 R61 E64 K65 K69 F8 T9 P11 K13 K16 K17 I18 V19 P20 R21 W22 K23 R27 V29 F31 R38 H39 K41 I46 I47 D48 N52 E53 W56 E57 R58 E61 K62 K66
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Mar 9 09:14:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'Aa', title = 'Structure of the SecY channel during initiation of protein translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='Aa', title='Structure of the SecY channel during initiation of protein translocation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4n', asym_id = 'Aa'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4n', asym_id='Aa')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>