Structure of PDB 8ova Chain AZ |
>8ovaAZ (length=58) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] |
QAQVGVIIKVLGRTGSRGNVTQVRVRLMANRTIVRNVKGPCKEGDMLSLM ETEREARR |
|
PDB | 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei. |
Chain | AZ |
Resolution | 2.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
AZ |
S52 R53 G54 P83 |
S16 R17 G18 P40 |
|
|
|
|