Structure of PDB 8cre Chain AZ

Receptor sequence

>8creAZ (length=292) Species: 5476 (Candida albicans) [Search protein sequence]

MQKEFRTSAYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLV
VRFTNKDIIAQIVSAHITGDVVFTAAYAHELPRYGIKYGLTNWSAAYAVG
LLVARRALQKLGLDETYTGVEEVEGEFELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGG
HVAEYMEELLDDDEEKYKSIFKNYIEEEIESEDVEEIYANAHEAIRADPS
FKPTEKKFTKEQYKAESKKYRQQKLTRAERQAKVAKKIAEFK

3D structure

PDB

8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AZ	M3 Q4 K5 R8 A11 Y12 R15 F16 Q17 R23 G26 T28 Y31 R35 L36 K43 Y44 K48 L113 P139 R140 P141 F145 I148 L150 R152 T153 P174 H175 S176 N178 R179	M1 Q2 K3 R6 A9 Y10 R13 F14 Q15 R21 G24 T26 Y29 R33 L34 K41 Y42 K46 L111 P137 R138 P139 F143 I146 L148 R150 T151 P172 H173 S174 N176 R177
BS02	rna	AZ	S10 H13 S14 T18 F20 R21 R22 Q24 T28 Y30 R33 R50 V52 R54 T56 N57 K58 I69 T70 G71 D72 V73 V74 Y79 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 V204 Y207 K218 S221 I222 N225 Y226 F253 T256 F260 K262 Y265 K266 E268 S269 Y272 R273 Q274 K276 L277 R279 K285	S8 H11 S12 T16 F18 R19 R20 Q22 T26 Y28 R31 R48 V50 R52 T54 N55 K56 I67 T68 G69 D70 V71 V72 Y77 G89 N92 W93 R150 T152 T153 G154 A155 R156 Y196 H201 V202 Y205 K216 S219 I220 N223 Y224 F251 T254 F258 K260 Y263 K264 E266 S267 Y270 R271 Q272 K274 L275 R277 K283
BS03	MG	AZ	K266 K270	K264 K268

External links

PDB	RCSB:8cre, PDBe:8cre, PDBj:8cre
PDBsum	8cre
PubMed
UniProt	G1UAA6

[Back to BioLiP]