Structure of PDB 6vlz Chain AZ

Receptor sequence
>6vlzAZ (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
LSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYP
NHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRA
3D structure
PDB6vlz Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
ChainAZ
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AZ K32 H56 H75 K86 K95 K96 E98 K100 R101 K29 H53 H72 K83 K92 K93 E95 K97 R98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vlz, PDBe:6vlz, PDBj:6vlz
PDBsum6vlz
PubMed32737313
UniProtQ9Y291|RT33_HUMAN Small ribosomal subunit protein mS33 (Gene Name=MRPS33)

[Back to BioLiP]