Structure of PDB 4v68 Chain AZ

Receptor sequence

>4v68AZ (length=378) Species: 274 (Thermus thermophilus)

GEFIRTKPHVNVGTIGHVDHGKTTLTAALTFVTAAENPAHVEYETAKRHY
SHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVG
VPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALL
ALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVED
VFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTL
QEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLKKEE
GGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKP
VALEEGLRFAIREGGRTVGAGVVTKILE

3D structure

• PDB: 4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
• Chain: AZ
• Resolution: 6.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K24 T25 H85
• Catalytic site (residue number reindexed from 1): K22 T23 H58

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AZ	T230 G233 R234 G235 T268 R291	T203 G206 R207 G208 T241 R264
BS02	rna	AZ	D87 F229 T230 I231 R234 V237 E271 R274 G287 L289 R295 R330 T332 F335 Q341 T350 E390 G391 G392	D60 F202 T203 I204 R207 V210 E244 R247 G260 L262 R268 R303 T305 F308 Q314 T323 E363 G364 G365
BS03	PHA	AZ	H67 T239 M272 H273 R274	H40 T212 M245 H246 R247
BS04	GDP	AZ	D21 G23 K24 T25 T26 N136 K137 D139 M140 S174 L176	D19 G21 K22 T23 T24 N109 K110 D112 M113 S147 L149
BS05	MAU	AZ	I93 L121 R124 Q125 V126 Y161 E162 E327 R385 F386 A387 T394 A397	I66 L94 R97 Q98 V99 Y134 E135 E300 R358 F359 A360 T367 A370

Gene Ontology

Molecular Function

• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4v68, PDBe:4v68, PDBj:4v68
• PDBsum: 4v68
• PubMed: 19229291
• UniProt: P60339|EFTU2_THET8 Elongation factor Tu-B (Gene Name=tufB)