Structure of PDB 4v62 Chain AZ

Receptor sequence
>4v62AZ (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL
VLVVGVLNFFVV
3D structure
PDB4v62 Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride
ChainAZ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide AZ F17 I21 V25 A28 F17 I21 V25 A28
BS02 CLA AZ V20 P24 V20 P24
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v62, PDBe:4v62, PDBj:4v62
PDBsum4v62
PubMed19219048
UniProtQ8DHJ2|PSBZ_THEVB Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]