Structure of PDB 4v5r Chain AZ

Receptor sequence

>4v5rAZ (length=385) Species: 300852 (Thermus thermophilus HB8)

AKGEFVRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVINTAHVEY
ETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPV
IRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKP
FLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGV
EMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASV
YVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTF
TVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE

3D structure

• PDB: 4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: AZ
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AZ	T230 T232 G233 R234 G235 T236 T268 R291	T210 T212 G213 R214 G215 T216 T248 R271
BS02	rna	AZ	N64 H67 D87 Y88 K90 N91 F229 I231 T232 G269 V270 E271 M272 H273 R274 N285 V286 G287 R300 R330 H331 T332 F335 G337 Y338 R339 Q341 T350 K376 E390 G391 G392	N44 H47 D67 Y68 K70 N71 F209 I211 T212 G249 V250 E251 M252 H253 R254 N265 V266 G267 R280 R310 H311 T312 F315 G317 Y318 R319 Q321 T330 K356 E370 G371 G372
BS03	rna	AZ	H19 V20 H85 P114	H19 V20 H65 P94
BS04	GDP	AZ	D21 H22 G23 K24 T25 T26 N136 K137 S174 L176	D21 H22 G23 K24 T25 T26 N116 K117 S154 L156
BS05	KIR	AZ	I93 L121 R124 Q125 Y161 E162 E326 E327 F344 R385 F386 A387 R389 T394 A397	I73 L101 R104 Q105 Y141 E142 E306 E307 F324 R365 F366 A367 R369 T374 A377

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
• PDBsum: 4v5r
• PubMed: 21378964
• UniProt: Q5SHN6|EFTU1_THET8 Elongation factor Tu-A (Gene Name=tufA)