Structure of PDB 4v5g Chain AZ

Receptor sequence

>4v5gAZ (length=374) Species: 300852 (Thermus thermophilus HB8)

TKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVHVEYETAKRHYSHVD
CPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYI
VVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALEQ
MHRNPKTRRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVEDVFTI
TGRGTVATGRIERGKVKVGDEVEIVGLAPETRRTVVTGVEMHRKTLQEGI
AGDNVGVLLRGVSREEVERGQVLAKPGSITPHTKFEASVYVLKKEEGGRH
TGFFSGYRPQFYFRTTDVTGVVQLPPGVEMVMPGDNVTFTVELIKPVALE
EGLRFAIREGGRTVGAGVVTKILE

3D structure

• PDB: 4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
• Chain: AZ
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.3: protein-synthesizing GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AZ	T232 G233 R234 R291	T201 G202 R203 R260
BS02	rna	AZ	K90 F229 T230 I231 R234 V237 T239 G269 E271 R274 G287 L289 R300 R330 H331 T332 F335 Y338 R339 Q341 D348 T350 I375 K376 E390 G391	K59 F198 T199 I200 R203 V206 T208 G238 E240 R243 G256 L258 R269 R299 H300 T301 F304 Y307 R308 Q310 D317 T319 I344 K345 E359 G360
BS03	rna	AZ	H19 V20 H85	H12 V13 H54
BS04	GDP	AZ	D21 G23 K24 T25 T26 N136 K137 M140 S174 L176	D14 G16 K17 T18 T19 N105 K106 M109 S143 L145
BS05	KIR	AZ	I93 E118 L121 R124 Q125 V126 Y161 E327 R345 R385 F386 A387 A397	I62 E87 L90 R93 Q94 V95 Y130 E296 R314 R354 F355 A356 A366

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4v5g, PDBe:4v5g, PDBj:4v5g
• PDBsum: 4v5g
• PubMed: 19833920
• UniProt: Q5SHN6|EFTU1_THET8 Elongation factor Tu-A (Gene Name=tufA)