Structure of PDB 3jbp Chain AZ

Receptor sequence

>3jbpAZ (length=121) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

KFNKQKSSSRRKMRKAHFTAPAGLRRKIMSSKLSKELRLKYKTRSLPVRK
DDEVLICRGHNHGREGKVVKINRKRYKIYVERVTREKVNGESTFIGIHPS
NVVLTKLKVDKNRKKILDRKA

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AZ	K2 F3 N4 K5 K7 S8 S9 S10 R11 K13 M14 R15 K33 K36 R39 R45 S46 R59 G60 H61 K71 R76 K78 Y80 R86 K88 V89 N90 T94 H99 S101 R120 K121	K1 F2 N3 K4 K6 S7 S8 S9 R10 K12 M13 R14 K32 K35 R38 R44 S45 R58 G59 H60 K70 R75 K77 Y79 R85 K87 V88 N89 T93 H98 S100 R119 K120
BS02	rna	AZ	R11 R12 R15 K16 F19 A23 R27 R50 K51 R74 K75 K112 K116	R10 R11 R14 K15 F18 A22 R26 R49 K50 R73 K74 K111 K115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links