Structure of PDB 6q8y Chain AY

Receptor sequence
>6q8yAY (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY
YAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
3D structure
PDB6q8y Structure of the 80S ribosome-Xrn1 nuclease complex.
ChainAY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AY L25 G26 K28 S29 P49 V50 R52 S54 F85 R86 V87 L17 G18 K20 S21 P41 V42 R44 S46 F77 R78 V79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0030627 pre-mRNA 5'-splice site binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q8y, PDBe:6q8y, PDBj:6q8y
PDBsum6q8y
PubMed30911188
UniProtP14120|RL30_YEAST Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]