Structure of PDB 6fxc Chain AY |
>6fxcAY (length=59) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence] |
MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDI SSDSHPFYT |
|
PDB | 6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus. |
Chain | AY |
Resolution | 6.76 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
AY |
M1 K2 I5 H6 |
M1 K2 I5 H6 |
|
|
|
|