Structure of PDB 6c5l Chain AY

Receptor sequence

>6c5lAY (length=351) Species: 274 (Thermus thermophilus)

LAQRLEGLRGYLDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARL
RRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQT
LLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVD
LTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSF
AGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLP
TGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVRPI
EWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGR
R

3D structure

• PDB: 6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
• Chain: AY
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AY	E78 L79 P80 G123 A124 G126 R188 S198 R200 R201 W307 G308 Q310 K318 Y320 K322 M329	E73 L74 P75 G118 A119 G121 R183 S193 R195 R196 W302 G303 Q305 K313 Y315 K317 M324
BS02	rna	AY	E161 G238 R266 K270	E156 G233 R261 K265
BS03	rna	AY	G125 T127 E128 S193 R200 R201 H202 T203	G120 T122 E123 S188 R195 R196 H197 T198
BS04	rna	AY	W39 R46 S49 Q121 M232 R233 S235 G236 P237 G238 X240 G241 N243 T244 T245 D246 R250 T261 T264 R266 Q268 K296	W34 R41 S44 Q116 M227 R228 S230 G231 P232 G233 X235 G236 N238 T239 T240 D241 R245 T256 T259 R261 Q263 K291

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
• PDBsum: 6c5l
• PubMed: 29403017
• UniProt: Q5SM01|RF2_THET8 Peptide chain release factor RF2 (Gene Name=prfB)