Structure of PDB 4v9n Chain AY

Receptor sequence

>4v9nAY (length=362) Species: 262724 (Thermus thermophilus HB27)

NASRNAWKASGGIFDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAA
RLRRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYH
QTLLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEV
VDLTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHT
SFAGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGPGVNTTDSAVRVVH
LPTGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVR
PIEWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKA
GRRQGTEEVEAE

3D structure

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Chain: AY
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AY	G136 A137 G139 R155 R201 S211 R214 E319 W320 D330 K331 N332 Y333 K335	G120 A121 G123 R139 R185 S195 R198 E303 W304 D314 K315 N316 Y317 K319
BS02	rna	AY	G138 G139 T140 E141 S206 R213 R214 H215 T216	G122 G123 T124 E125 S190 R197 R198 H199 T200
BS03	rna	AY	W52 E56 R59 D178 M245 R246 S248 P250 G251 G252 P253 G254 V255 N256 T257 T258 D259 R263 V273 T274 R279 Q281 R295 K309	W36 E40 R43 D162 M229 R230 S232 P234 G235 G236 P237 G238 V239 N240 T241 T242 D243 R247 V257 T258 R263 Q265 R279 K293
BS04	MG	AY	G251 G252	G235 G236

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: Q72GJ6