Structure of PDB 4v95 Chain AY

Receptor sequence

>4v95AY (length=132) Species: 83333 (Escherichia coli K-12)

IVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEY
YKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTE
KKARRPTRPTRASKERRLASKAQKSSVKAMRG

3D structure

• PDB: 4v95 Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.
• Chain: AY
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.1.1.29: peptidyl-tRNA hydrolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AY	T108 P110 S114 R117 R118 L119 K122 A123 Q124 M131 R132	T107 P109 S113 R116 R117 L118 K121 A122 Q123 M130 R131
BS02	rna	AY	G26 G27 Q28 Y77 R78	G25 G26 Q27 Y76 R77
BS03	rna	AY	I20 R21 A22 Q23 G24 A25 G26 G27 Q28 H29 V30 N31 K32 T33 S34 T35 L39 F41 H61 H62 S66 D67 V71 K73 E76 Y77 R78 Q80 R90 R105 R106 T108	I19 R20 A21 Q22 G23 A24 G25 G26 Q27 H28 V29 N30 K31 T32 S33 T34 L38 F40 H60 H61 S65 D66 V70 K72 E75 Y76 R77 Q79 R89 R104 R105 T107

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0004045 aminoacyl-tRNA hydrolase activity
• GO:0016787 hydrolase activity
• GO:0043022 ribosome binding

Biological Process

• GO:0006415 translational termination
• GO:0006417 regulation of translation
• GO:0072344 rescue of stalled ribosome

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4v95, PDBe:4v95, PDBj:4v95
• PDBsum: 4v95
• PubMed: 22422986
• UniProt: P40711|ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB (Gene Name=arfB)