Structure of PDB 4v8y Chain AY

Receptor sequence
>4v8yAY (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD
3D structure
PDB4v8y Molecular architecture of a eukaryotic translational initiation complex.
ChainAY
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AY R8 T9 R10 K11 V12 S14 K21 A33 K37 V47 Y48 G59 R61 T62 F64 S104 R105 Q106 R108 K109 K112 N113 K116 F119 G120 T121 R124 R7 T8 R9 K10 V11 S13 K20 A32 K36 V46 Y47 G58 R60 T61 F63 S103 R104 Q105 R107 K108 K111 N112 K115 F118 G119 T120 R123
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum4v8y
PubMed24200810
UniProtP0CX31|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)

[Back to BioLiP]