Structure of PDB 4v5j Chain AY

Receptor sequence

>4v5jAY (length=351) Species: 300852 (Thermus thermophilus HB8)

LAQRLEGLRGYLDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARL
RRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQT
LLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVD
LTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSF
AGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLP
TGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVRPI
EWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGR
R

3D structure

• PDB: 4v5j Structure of the 70S ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release.
• Chain: AY
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AY	E78 L79 P80 G123 A124 G126 R188 S198 R201 E306 W307 G308 Q310 K318 K322 H324	E73 L74 P75 G118 A119 G121 R183 S193 R196 E301 W302 G303 Q305 K313 K317 H319
BS02	rna	AY	P160 G238 G239 Q240 R266	P155 G233 G234 Q235 R261
BS03	rna	AY	G125 T127 E128 S193 R200 R201 H202 T203	G120 T122 E123 S188 R195 R196 H197 T198
BS04	rna	AY	W39 S49 Q121 M232 R233 S235 G236 P237 G238 G239 Q240 G241 N243 T244 T245 D246 R250 T261 Q268	W34 S44 Q116 M227 R228 S230 G231 P232 G233 G234 Q235 G236 N238 T239 T240 D241 R245 T256 Q263

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4v5j, PDBe:4v5j, PDBj:4v5j
• PDBsum: 4v5j
• PubMed: 20421507
• UniProt: Q5SM01|RF2_THET8 Peptide chain release factor RF2 (Gene Name=prfB)