Structure of PDB 4v5e Chain AY

Receptor sequence

>4v5eAY (length=351) Species: 300852 (Thermus thermophilus HB8)

LAQRLEGLRGYLDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARL
RRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQT
LLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVD
LTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSF
AGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLP
TGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVEPI
EWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGR
R

3D structure

• PDB: 4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
• Chain: AY
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AY	G123 A124 G126 R138 R142 R188 R200 R201 I305 E306 W307 G308 Q310 K318 M329	G118 A119 G121 R133 R137 R183 R195 R196 I300 E301 W302 G303 Q305 K313 M324
BS02	rna	AY	E161 G238 G239 Q240 R266 K270	E156 G233 G234 Q235 R261 K265
BS03	rna	AY	G125 E128 S193 R201 H202 T203	G120 E123 S188 R196 H197 T198
BS04	rna	AY	L33 P36 W39 P42 E43 R46 K47 Q121 M232 R233 S235 P237 G238 G239 Q240 G241 V242 N243 T244 T245 D246 S247 R250 T261 R266 Q268 K296	L28 P31 W34 P37 E38 R41 K42 Q116 M227 R228 S230 P232 G233 G234 Q235 G236 V237 N238 T239 T240 D241 S242 R245 T256 R261 Q263 K291

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
• PDBsum: 4v5e
• PubMed: 18988853
• UniProt: Q5SM01|RF2_THET8 Peptide chain release factor RF2 (Gene Name=prfB)