Structure of PDB 7mpj Chain AX

Receptor sequence

>7mpjAX (length=121) Species: 4932 (Saccharomyces cerevisiae)

KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI

3D structure

• PDB: 7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: AX
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AX	L24 T31 F32 R33 L34 P35 K36 K39 L40 R42 A43 P44 K45 Y46 S69 T71 K75 N91 K92 Y93 K109 N111 T112 L113 V114 P116 K120 K121 Y123 R125	L3 T10 F11 R12 L13 P14 K15 K18 L19 R21 A22 P23 K24 Y25 S48 T50 K54 N70 K71 Y72 K88 N90 T91 L92 V93 P95 K99 K100 Y102 R104
BS02	rna	AX	K22 L24 P35 T37 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 N91 Y93 Q94 K97	K1 L3 P14 T16 L17 R21 S27 K28 H32 Y33 N34 R35 K40 K68 N70 Y72 Q73 K76
BS03	MG	AX	R42 P44	R21 P23

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
• PDBsum: 7mpj
• PubMed: 35489333
• UniProt: P04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)