Structure of PDB 6zm5 Chain AX

Receptor sequence

>6zm5AX (length=352) Species: 9606 (Homo sapiens)

AISRTNENDPAKHGDQHEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSE
ACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCA
KQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNE
RFLNQIKVQEKYVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKE
LKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKM
MKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVS
NYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCA
YL

3D structure

• PDB: 6zm5 Mechanism of membrane-tethered mitochondrial protein synthesis.
• Chain: AX
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AX	K130 N164 R166 K279 F317 K318 S389 L390 R393	K84 N118 R120 K233 F271 K272 S343 L344 R347
BS02	ATP	AX	L99 M100 K130 G131 G133 K134 T135 L136 T313 Y348 P388	L53 M54 K84 G85 G87 K88 T89 L90 T267 Y302 P342
BS03	GTP	AX	Y173 R177 Y208 V209 G241 I242 K245 K295	Y127 R131 Y162 V163 G195 I196 K199 K249

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006915 apoptotic process
• GO:0032543 mitochondrial translation
• GO:0097190 apoptotic signaling pathway

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zm5, PDBe:6zm5, PDBj:6zm5
• PDBsum: 6zm5
• PubMed: 33602856
• UniProt: P51398|RT29_HUMAN Small ribosomal subunit protein mS29 (Gene Name=DAP3)