Structure of PDB 6uz7 Chain AX

Receptor sequence
>6uz7AX (length=121) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
KALKVRTSASFRLPKTLKLARSPKYATKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNTLVFKVSLKANKYQIKKAVKELYEVDVLSVNTLVRPNGTKK
AYVRLTADFDALDIANRIGYI
3D structure
PDB6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
ChainAX
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AX L24 S31 R33 L34 R42 S43 K45 Y46 T71 N91 K92 Y93 V114 K120 Y123 R125 L3 S10 R12 L13 R21 S22 K24 Y25 T50 N70 K71 Y72 V93 K99 Y102 R104
BS02 rna AX K22 K25 T37 L38 R42 H53 Y54 N55 R56 K61 K89 Y93 Q94 K1 K4 T16 L17 R21 H32 Y33 N34 R35 K40 K68 Y72 Q73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
PDBsum6uz7
PubMed31900355
UniProtP48045|RL25_KLULA Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]