Structure of PDB 4v6o Chain AX

Receptor sequence

>4v6oAX (length=70) Species: 562 (Escherichia coli)

PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AX
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AX	R17 F18 C22 E23 A25 G26 V27 R32 R34 E35 F36 Y37 E38 K39 T41 K45 R46 A47 K48 S50 A51 R54 K58 R65 R68 L69 Y70	R17 F18 C22 E23 A25 G26 V27 R32 R34 E35 F36 Y37 E38 K39 T41 K45 R46 A47 K48 S50 A51 R54 K58 R65 R68 L69 Y70
BS02	rna	AX	P1 V5 E7 N8 E9 R16 R17 F18 K19 R20 E23 A29 E30 R46	P1 V5 E7 N8 E9 R16 R17 F18 K19 R20 E23 A29 E30 R46

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)