Structure of PDB 7aoi Chain AW

Receptor sequence

>7aoiAW (length=277) Species: 5691 (Trypanosoma brucei)

PRPAPRFAMGHMLPHRSNVGSQFLHTQRHGSRSTWYKKHYFSLRPFAIQR
HHGTTPRILLDRSLWKSLWITKLQLPDINRWERVVNSRRVTEDRYAFVEE
EGVMHKVNWGLYCERLETELTVTQERLPQHTLLMKAVPSSWKKLDIDISV
IRGLSLREAMAQCKLSLRKGHQIVFRALEMAQQGAEAKGLDKEHLRVAHI
SCYPGPTDKQIDIRSKGYYAWKTKKSSHLVLTLAEDPEMVLPDRTCLPYS
SLMSMKRAGLSAQPTVIDVPAITADGI

3D structure

• PDB: 7aoi Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit.
• Chain: AW
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	P2 R3 P4 P6 H12 H16 R17 S18 N19 G21 S22 Q23 F24 L25 Q28 R29 H30 G31 S32 R33 Y37 K38 K39 H40 Y41 R45 F47 Q50 H52 H53 G54 T55 T56 P57 R58 I59 K67 L69 I71 K73 L74 W82 R84 V85 R95 Y96 W142 K144 R153 S167 L168 R169 K170 H200 D213 I214 R215 G218 Y219 Y220 T224 K225	P1 R2 P3 P5 H11 H15 R16 S17 N18 G20 S21 Q22 F23 L24 Q27 R28 H29 G30 S31 R32 Y36 K37 K38 H39 Y40 R44 F46 Q49 H51 H52 G53 T54 T55 P56 R57 I58 K66 L68 I70 K72 L73 W81 R83 V84 R94 Y95 W141 K143 R152 S166 L167 R168 K169 H199 D212 I213 R214 G217 Y218 Y219 T223 K224

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aoi, PDBe:7aoi, PDBj:7aoi
• PDBsum: 7aoi
• PubMed: 33576519
• UniProt: A0A3L6L4Z4