Structure of PDB 6hiv Chain AW

Receptor sequence

>6hivAW (length=276) Species: 5702 (Trypanosoma brucei brucei)

PRPAPRFAMGHMLPHRSNVGSQFLHTQRHGSRSTWYKKHYFSLRPFAIQR
HHGTTPRILLDRSLWKSLWITKLQLPDINRWERVVNSRRVTEDRYAFVEE
EGVMHKVNWGLYCERLETELTVTQERLPQHTLLMKAVPSSWKKLDIDISV
IRGLSLREAMAQCKLSLRKGHQIVFRALEMAQQGAEAKGLDKEHLRVAHI
SCYPGPTDKQIDIRSKGYYAWKTKKSSHLVLTLAEDPEMVLPDRTCLPYS
SLMSMKRAGLSAQPTVIDVPAITADG

3D structure

• PDB: 6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
• Chain: AW
• Resolution: 7.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	P2 R3 P4 P6 R7 H12 H16 R17 S18 N19 G21 S22 Q23 F24 L25 Q28 H30 G31 S32 R33 Y37 K39 H40 Y41 R45 F47 Q50 H52 H53 G54 T55 T56 P57 L61 K67 S68 L69 I71 K73 L74 W82 R84 Y96 W142 K143 K144 R153 K170 H200 I214 Y219 A221 K225	P1 R2 P3 P5 R6 H11 H15 R16 S17 N18 G20 S21 Q22 F23 L24 Q27 H29 G30 S31 R32 Y36 K38 H39 Y40 R44 F46 Q49 H51 H52 G53 T54 T55 P56 L60 K66 S67 L68 I70 K72 L73 W81 R83 Y95 W141 K142 K143 R152 K169 H199 I213 Y218 A220 K224

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hiv, PDBe:6hiv, PDBj:6hiv
• PDBsum: 6hiv
• PubMed: 30213880
• UniProt: C9ZSI8