Structure of PDB 6gq1 Chain AW

Receptor sequence
>6gq1AW (length=37) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KLRRECSNPTCGAGVFLANHKDRLYCGKCHSVYKVNA
3D structure
PDB6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
ChainAW
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AW F131 L132 A133 H135 K136 R138 Y140 G142 K143 H145 S146 K149 F16 L17 A18 H20 K21 R23 Y25 G27 K28 H30 S31 K34
BS02 ZN AW C141 Y148 C26 Y33
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
PDBsum6gq1
PubMed29886014
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]