Structure of PDB 4v9q Chain AW

Receptor sequence

>4v9qAW (length=76) Species: 262724 (Thermus thermophilus HB27)

TKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
• Chain: AW
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	N12 R14 D15 S16 Q17 K19 R20 V23 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 T58 F60 F69 L75 R77	N3 R5 D6 S7 Q8 K10 R11 V14 K15 Y17 E18 Q20 R23 A24 G25 N26 I27 R30 R32 G33 T34 R35 G45 R46 D47 F48 T49 F51 F60 L66 R68
BS02	rna	AW	R72 R74 L75	R63 R65 L66
BS03	MG	AW	R25 I36	R16 I27

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
• PDBsum: 4v9q
• PubMed: 23824292
• UniProt: Q72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)