Structure of PDB 4v65 Chain AW

Receptor sequence

>4v65AW (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading

Chain

Resolution

9.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	Q4 Y6 T8 R10 K12 R17 F19 K21 R40 K67 G68 G69 G70 I71 S72 R84 R94 R98 T104 R105 A107 R108 Q109 V110 E111 R112 K113 K114 R118 K119 R121 R122 R123 P124 Q125 F126 S127 K128 R129	Q2 Y4 T6 R8 K10 R15 F17 K19 R38 K65 G66 G67 G68 I69 S70 R82 R92 R96 T102 R103 A105 R106 Q107 V108 E109 R110 K111 K112 R116 K117 R119 R120 R121 P122 Q123 F124 S125 K126 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum	4v65
PubMed
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)