Structure of PDB 3jbp Chain AW

Receptor sequence

>3jbpAW (length=170) Species: 36329 (Plasmodium falciparum 3D7)

YAKKIRNLGKCAKGAGVDLRVHFKNTYEAARAIRRMKLLEAKKYLNDVIE
KKRCVPFRKYNGGVGRTNQAKEFNHTQGRWPAKSCKFLLNILDNVQANAE
SRNLDVSKLRLIHVMVNKARPGRRRTYKAHGRINPFMSSPCHIQIIAREI
NAAAAAAAAAAAAAAAAAAA

3D structure

• PDB: 3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.
• Chain: AW
• Resolution: 6.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	Y4 K6 K16 A18 R23 H25 K27 Y30 R34 R37 R38 K46 R56 Y63 G65 G66 G68 R69 N71 K74 T79 Q80 R82 W83 P84 K86 N97 A100 N101 S104 R105 R113 H116 V119 K121 R127 Y130 K131 A132 H133 G134 I136 P138 F139 M140 S141 R151 I153 X200 X201 X210 X213	Y1 K3 K13 A15 R20 H22 K24 Y27 R31 R34 R35 K43 R53 Y60 G62 G63 G65 R66 N68 K71 T76 Q77 R79 W80 P81 K83 N94 A97 N98 S101 R102 R110 H113 V116 K118 R124 Y127 K128 A129 H130 G131 I133 P135 F136 M137 S138 R148 I150 X155 X156 X165 X168
BS02	rna	AW	R38 R61 K62 R113 N120 R123	R35 R58 K59 R110 N117 R120

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit

External links

• PDB: RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
• PDBsum: 3jbp
• PubMed: 26432834
• UniProt: Q8IDI5