Structure of PDB 3jbn Chain AW

Receptor sequence

>3jbnAW (length=170) Species: 36329 (Plasmodium falciparum 3D7)

YAKKIRNLGKCAKGAGVDLRVHFKNTYEAARAIRRMKLLEAKKYLNDVIE
KKRCVPFRKYNGGVGRTNQAKEFNHTQGRWPAKSCKFLLNILDNVQANAE
SRNLDVSKLRLIHVMVNKARPGRRRTYKAHGRINPFMSSPCHIQIIAREI
NAAAAAAAAAAAAAAAAAAA

3D structure

• PDB: 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
• Chain: AW
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AW	K6 K7 R9 K16 A18 R23 H25 K27 N28 Y30 R34 R37 R38 K46 R56 Y63 N64 G65 V67 G68 R69 N71 K74 T79 R82 W83 P84 A85 K86 N101 V119 K121 R126 R127 T129 Y130 K131 A132 H133 G134 R135 N137 P138 F139 M140 R151 X210 X213	K3 K4 R6 K13 A15 R20 H22 K24 N25 Y27 R31 R34 R35 K43 R53 Y60 N61 G62 V64 G65 R66 N68 K71 T76 R79 W80 P81 A82 K83 N98 V116 K118 R123 R124 T126 Y127 K128 A129 H130 G131 R132 N134 P135 F136 M137 R148 X165 X168
BS02	rna	AW	R61 K62 R113 R123 H145 N154	R58 K59 R110 R120 H142 N151

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit

External links

• PDB: RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
• PDBsum: 3jbn
• PubMed: 26432834
• UniProt: Q8IDI5