Structure of PDB 8ove Chain AV

Receptor sequence

>8oveAV (length=103) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

TTKRRNHGRAKPPCSRGRVRPVHCFNCSRLVPKDKSVGRFVVRRMLDQAS
ARDVAEASLIYGSGFPMPKLYMKQRYCIACAIHSRTVRARPVEDRKRRYT
SKV

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AV	T2 T3 K4 R5 R6 N7 H8 G9 R10 P13 P14 C15 S16 R17 G18 R19 R21 K34 K36 R40 F41 K74 R76 I79 I83 R89 R91 P92 V93 R96 K97 R99 Y100 K103	T1 T2 K3 R4 R5 N6 H7 G8 R9 P12 P13 C14 S15 R16 G17 R18 R20 K33 K35 R39 F40 K73 R75 I78 I82 R88 R90 P91 V92 R95 K96 R98 Y99 K102

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links